PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC507_p4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 352aa    MW: 38302.5 Da    PI: 6.7726
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC507_p4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.2e-41109185278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC++d+s+++eyh+rhkvC+vhsk+pvv++sg +qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  RrC507_p4 109 CLVDGCDSDFSNCREYHKRHKVCDVHSKTPVVTISGDKQRFCQQCSRFHALEEFDEGKRSCRKRLDGHNRRRRKPQP 185
                **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-32102170IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.847106183IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-38107187IPR004333Transcription factor, SBP-box
PfamPF031103.5E-30109182IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDWNFKLSSG SFPDFDEESV PDLTPIDASV SFGGSSSSPR LEPKGEFSFD LKLGTNIVNS  60
SAAFGNTEQV TCLKWKESTA LAKPEASRSS GSTKRTRGNA TGNNQIPLCL VDGCDSDFSN  120
CREYHKRHKV CDVHSKTPVV TISGDKQRFC QQCSRFHALE EFDEGKRSCR KRLDGHNRRR  180
RKPQPDQGRK LLEFPSASHV FPTTSVGTPS SWGNGLVSVA MANGSSYGEN QISYAVSSPA  240
KPGSMFPDSS SLNSRGKQFP FLQEEVSSRT AFLGERMTSC VHDSDCALSL LSPSSSSTPH  300
LLQPPLPLSQ EAVETVFNQS GLFENASAVS DGSVISGNEI VALPQTFPFH WE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29100182284squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165182KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC8159601e-117KC815960.1 Arabis alpina SQUAMOSA promoter binding protein-like protein 13 (SPL13) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680917.10.0PREDICTED: squamosa promoter-binding-like protein 13A
SwissprotB9DI201e-174SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI111e-174SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLA0A078HB600.0A0A078HB60_BRANA; BnaC03g27870D protein
STRINGscaffold_801495.11e-174(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-155SBP family protein